DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and clic1

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_997847.1 Gene:clic1 / 324481 ZFINID:ZDB-GENE-030131-3202 Length:241 Species:Danio rerio


Alignment Length:54 Identity:15/54 - (27%)
Similarity:22/54 - (40%) Gaps:20/54 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 QGLKLLETFLGNSP-------------------YLAGDSLTLADLSTGPTVSAV 172
            :.||.|:.:| :||                   :|.|..|||||.:..|.:..|
Zfish   135 KALKKLDDYL-SSPLPDEIDENSADDVISSTRSFLDGQELTLADCNLLPKLHIV 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343
GstA 8..197 CDD:223698 15/54 (28%)
GST_C_Delta_Epsilon 94..210 CDD:198287 15/54 (28%)
clic1NP_997847.1 GST_N_CLIC 3..93 CDD:239359
O-ClC 6..241 CDD:129941 15/54 (28%)
GST_C_CLIC1 100..238 CDD:198333 15/54 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589705
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.