DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and Clic

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster


Alignment Length:188 Identity:35/188 - (18%)
Similarity:72/188 - (38%) Gaps:35/188 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHAI 73
            |..||........::|||..:|.:....:.:.      .:...:|    |:|.|||..|.::..|
  Fly    46 YFMDLYLLAELKTISLKVTTVDMQKPPPDFRT------NFEATHP----PILIDNGLAILENEKI 100

  Fly    74 AAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEVPQEKLDAVHQ 138
            ..:::........|:.:|.....::..        :|..:..:        :.:..:.|.:|:..
  Fly   101 ERHIMKNIPGGYNLFVQDKEVATLIEN--------LYVKLKLM--------LVKKDEAKNNALLS 149

  Fly   139 GLKLLETFLG--NSPYLAGDSLTLADLSTGPTVSAVPAA----VDIDPATYPKVTA-W 189
            .|:.:...|.  |:.:|.||::...|....|.:..:..|    ||.:..|:  :|| |
  Fly   150 HLRKINDHLSARNTRFLTGDTMCCFDCELMPRLQHIRVAGKYFVDFEIPTH--LTALW 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 15/69 (22%)
GstA 8..197 CDD:223698 35/188 (19%)
GST_C_Delta_Epsilon 94..210 CDD:198287 18/103 (17%)
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 15/75 (20%)
O-ClC 21..231 CDD:129941 35/188 (19%)
GST_C_CLIC 118..232 CDD:198307 19/106 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460392
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.