DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and Gdap1

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001101367.1 Gene:Gdap1 / 312890 RGDID:1309005 Length:358 Species:Rattus norvegicus


Alignment Length:232 Identity:48/232 - (20%)
Similarity:77/232 - (33%) Gaps:70/232 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDS 70
            ::||....|...:.|:|.:....|..|..:|:|...||....:::.|....||:|......|.::
  Rat    26 LILYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPLSEHNEPWFMRLNSTGEVPVLIHGENIICEA 90

  Fly    71 HAIAAYL-----------------------VDKYAKSDELYPKD-LAKRAIVNQRLFFDASV--- 108
            ..|..||                       |..|.:..:..|.| .....|::..|..|:.:   
  Rat    91 TQIIDYLEQTFLDERTPRLMPDEGSMYYPRVQHYRELLDSLPMDAYTHGCILHPELTVDSMIPAY 155

  Fly   109 ----IYASIANVS-------------RPFWINGVTEVPQEKLDAVHQGLKLLETFL--------- 147
                |...|.|..             :..:|.....:..:.||  |..:|.|:..|         
  Rat   156 ATTRIRGQIGNTESELKKLAEENPDLQEAYIAKQKRLKSKLLD--HDNVKYLKKILDELEKVLDQ 218

  Fly   148 ---------------GNSPYLAGDSLTLADLSTGPTV 169
                           ||.|:|.|:|.||||:|...|:
  Rat   219 VETELQRRNEETPDEGNQPWLCGESFTLADVSLAVTL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 19/95 (20%)
GstA 8..197 CDD:223698 48/230 (21%)
GST_C_Delta_Epsilon 94..210 CDD:198287 25/120 (21%)
Gdap1NP_001101367.1 GstA 26..292 CDD:223698 48/232 (21%)
GST_N_GDAP1 26..98 CDD:239350 18/71 (25%)
GST_C_GDAP1 179..289 CDD:198336 19/79 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348319
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.