DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and Gdap1l1

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_038961050.1 Gene:Gdap1l1 / 311616 RGDID:1304960 Length:369 Species:Rattus norvegicus


Alignment Length:217 Identity:42/217 - (19%)
Similarity:71/217 - (32%) Gaps:68/217 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHAIAAYL------- 77
            |:|.:....|..|.::|:|...||....:::.|....||::......|.|...|..|:       
  Rat    64 VRLVIAEKGLSCEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQIIDYVERTFTGE 128

  Fly    78 ----------------VDKYAKSDELYPKD-LAKRAIVNQRLFFDASVIYASIANVSRPFWINGV 125
                            |.:|.:..:..|.| .....|::..|..|:.:...:.|.:.|.. .|..
  Rat   129 HVVALMPEAGSPQHARVLQYRELLDALPMDAYTHGCILHPELTTDSMIPKYATAEIRRHL-ANAT 192

  Fly   126 TEV----------------PQEKLDA---VHQGLKLLETFLGN---------------------- 149
            |::                .|:||.|   .|..:..|:..||.                      
  Rat   193 TDLMKLDHEEPQLSEPYLSKQKKLMAKILEHDDVGYLKKILGELAMVLDQIEAELEKRKLENEGQ 257

  Fly   150 --SPYLAGDSLTLADLSTGPTV 169
              ..:|.|.:.||||:..|.|:
  Rat   258 TCELWLCGCAFTLADVLLGATL 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 15/81 (19%)
GstA 8..197 CDD:223698 42/217 (19%)
GST_C_Delta_Epsilon 94..210 CDD:198287 23/119 (19%)
Gdap1l1XP_038961050.1 Thioredoxin_like 47..122 CDD:412351 15/57 (26%)
GST_C_family 203..313 CDD:413470 16/77 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348278
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.