DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and Clic6

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_788267.2 Gene:Clic6 / 304081 RGDID:727938 Length:613 Species:Rattus norvegicus


Alignment Length:187 Identity:44/187 - (23%)
Similarity:63/187 - (33%) Gaps:73/187 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHAIAAYLVDK- 80
            |.||.|..|..:|.      ||..|         .||    |.:..:|....|.:.|..:|.:| 
  Rat   415 VTTVDLKRKPADLQ------NLAPG---------TNP----PFMTFDGEVKTDVNKIEEFLEEKL 460

  Fly    81 ----YAKSDELYPKD-------LAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEVPQEKLD 134
                |.|....:|:.       .||.:...:....||:.||..  |:.|                
  Rat   461 VPPRYPKLGTQHPESNSAGNDVFAKFSAFIKNTKKDANDIYEK--NLLR---------------- 507

  Fly   135 AVHQGLKLLETFLGNSP-------------------YLAGDSLTLADLSTGPTVSAV 172
                .||.|:::| |||                   :|.||.|||||.:..|.:..:
  Rat   508 ----ALKKLDSYL-NSPLPDEIDAYSTEDVTVSQRKFLDGDELTLADCNLLPKLHII 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 16/61 (26%)
GstA 8..197 CDD:223698 44/187 (24%)
GST_C_Delta_Epsilon 94..210 CDD:198287 23/98 (23%)
Clic6NP_788267.2 2A1904 <51..318 CDD:273344
O-ClC 380..613 CDD:129941 44/187 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348030
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.