DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and Clic6

DIOPT Version :10

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_788267.2 Gene:Clic6 / 304081 RGDID:727938 Length:613 Species:Rattus norvegicus


Alignment Length:187 Identity:44/187 - (23%)
Similarity:63/187 - (33%) Gaps:73/187 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHAIAAYLVDK- 80
            |.||.|..|..:|.      ||..|         .||    |.:..:|....|.:.|..:|.:| 
  Rat   415 VTTVDLKRKPADLQ------NLAPG---------TNP----PFMTFDGEVKTDVNKIEEFLEEKL 460

  Fly    81 ----YAKSDELYPKD-------LAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEVPQEKLD 134
                |.|....:|:.       .||.:...:....||:.||..  |:.|                
  Rat   461 VPPRYPKLGTQHPESNSAGNDVFAKFSAFIKNTKKDANDIYEK--NLLR---------------- 507

  Fly   135 AVHQGLKLLETFLGNSP-------------------YLAGDSLTLADLSTGPTVSAV 172
                .||.|:::| |||                   :|.||.|||||.:..|.:..:
  Rat   508 ----ALKKLDSYL-NSPLPDEIDAYSTEDVTVSQRKFLDGDELTLADCNLLPKLHII 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GstA 6..201 CDD:440390 44/187 (24%)
Clic6NP_788267.2 2A1904 <51..318 CDD:273344
O-ClC 380..613 CDD:129941 44/187 (24%)
G-site. /evidence=ECO:0000250|UniProtKB:Q9Y696 396..399
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.