DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and Clic3

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001013098.2 Gene:Clic3 / 296566 RGDID:1307249 Length:237 Species:Rattus norvegicus


Alignment Length:140 Identity:36/140 - (25%)
Similarity:55/140 - (39%) Gaps:34/140 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PQHTVPMLDDNGTFIWDSHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVS 117
            |...:|:|..:|....|:..|..:|.:.....|  :| .||.|...:.....|  :.:...|.:.
  Rat    59 PGSQLPILLYDGDVKTDTLQIEEFLEETLGPPD--FP-GLAPRYRESNTAGND--IFHKFSAFIK 118

  Fly   118 RPFWINGVTEVPQEKLDAVHQ----GLKLLETFLG--------NSPYLA--------GDSLTLAD 162
            .|        ||.:. ||::|    .|..|:.:||        ..|:|:        ||.|||||
  Rat   119 NP--------VPTQD-DALYQQLLRALTRLDRYLGTPLDHELAQEPHLSESRRRFLDGDQLTLAD 174

  Fly   163 LSTGPTVSAV 172
            .|..|.:..|
  Rat   175 CSLLPKLHIV 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 7/25 (28%)
GstA 8..197 CDD:223698 36/140 (26%)
GST_C_Delta_Epsilon 94..210 CDD:198287 25/99 (25%)
Clic3NP_001013098.2 O-ClC 6..230 CDD:129941 36/140 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348176
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.