DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and GSTT4

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001345593.1 Gene:GSTT4 / 25774 HGNCID:26930 Length:241 Species:Homo sapiens


Alignment Length:162 Identity:46/162 - (28%)
Similarity:76/162 - (46%) Gaps:17/162 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHAIAAYLV 78
            :|| |.|.:..|..::.:.::.|:|..|.|.|:.|:..||...:|.|.|....:.:|.||..||.
Human    12 APC-RAVYIFSKKHDIQFNFQFVDLLKGHHHSKGYIDINPLRKLPSLKDGKFILSESAAILYYLC 75

  Fly    79 DKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFW-------INGVTEVPQEKL--- 133
            .||:......|.|...||.|::.:.:..:.....:..:   .|       |.| .||..||:   
Human    76 RKYSAPSHWCPPDPHARARVDEFVAWQHTAFQLPMKKI---VWLKLLIPKITG-EEVSAEKMEHA 136

  Fly   134 -DAVHQGLKLLET-FLGNSPYLAGDSLTLADL 163
             :.|...|:|.|. ||.:..::.|:.::||||
Human   137 VEEVKNSLQLFEEYFLQDKMFITGNQISLADL 168

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 21/64 (33%)
GstA 8..197 CDD:223698 46/162 (28%)
GST_C_Delta_Epsilon 94..210 CDD:198287 21/82 (26%)
GSTT4NP_001345593.1 Thioredoxin_like 3..78 CDD:320948 21/66 (32%)