DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and gst2

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_588517.1 Gene:gst2 / 2539601 PomBaseID:SPCC965.07c Length:230 Species:Schizosaccharomyces pombe


Alignment Length:240 Identity:74/240 - (30%)
Similarity:93/240 - (38%) Gaps:57/240 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDD---NGTFIWD 69
            ||.....|....|.|.||.|||.||....:.|.||...:|::..||...||.|.|   |...||:
pombe     6 LYSHAGGPNPWKVVLALKELNLSYEQIFYDFQKGEQKCKEHLALNPNGRVPTLVDHKNNDYTIWE 70

  Fly    70 SHAIAAYLVDKY--------AKSDELYPKDLAKRAIVNQRLFFDAS---VIYASIANVSRPFWIN 123
            |.||..||.|||        :..|..|.|       :.|.|||.||   ||:....      |.|
pombe    71 SDAILIYLADKYDTDRKISLSFDDPEYYK-------LIQYLFFQASGQGVIWGQAG------WFN 122

  Fly   124 ---------GVTEVPQEKLDAVHQGLKLLETFLGNSPYLAGDSLTLADLSTGP------------ 167
                     .||....|    :.:.|.:||..|.:..||..:..|:||||..|            
pombe   123 FFHHEPVVSAVTRYRNE----IKRVLGVLEDILKDRDYLVANKYTIADLSFIPWNYNLGGLFGEG 183

  Fly   168 ---TVSAVPAAVDIDPATYPKVTAWLDRLNKLPYYKEINEAPAQS 209
               ....|| .:|.: ..:||..||..||...|..|...|..|::
pombe   184 KFSFKEEVP-QLDFE-KEFPKAYAWNQRLLARPAVKATFEELAKA 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 30/73 (41%)
GstA 8..197 CDD:223698 70/226 (31%)
GST_C_Delta_Epsilon 94..210 CDD:198287 38/143 (27%)
gst2NP_588517.1 GST_N_Ure2p_like 4..84 CDD:239346 33/77 (43%)
GstA 5..226 CDD:223698 74/238 (31%)
GST_C_Ure2p 96..219 CDD:198326 38/141 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I3221
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I1854
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm9258
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.