DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and gst1

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_588298.1 Gene:gst1 / 2538694 PomBaseID:SPCC191.09c Length:229 Species:Schizosaccharomyces pombe


Alignment Length:201 Identity:61/201 - (30%)
Similarity:88/201 - (43%) Gaps:29/201 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDD---NGTFIWDSHAIAAYLVDKYAKSD 85
            ||.|:|.||.:.||....|..|.|::..||...||.|.|   |...||:|.||..||.|||....
pombe    22 LKELDLTYETRYVNFSKNEQKSPEHLALNPNGRVPTLIDHHNNDYTIWESDAILIYLADKYDTER 86

  Fly    86 EL-YPKDLAKRAIVNQRLFFDAS---VIYASIANVS---RPFWINGVTEVPQEKLDAVHQGLKLL 143
            :: .|:|..:...|.|.|||.||   :|:......|   :...|:.:|....|    :.:.|.:|
pombe    87 KISLPRDHPEYYKVIQYLFFQASGQGIIWGQAGWFSVYHQELVISAITRYRNE----IKRVLGVL 147

  Fly   144 ETFLGNSPYLAGDSLTLADLS-------------TGP-TVSAVPAAVDIDPATYPKVTAWLDRLN 194
            |..|.:..||..:..|:||||             .|. ::......:|.: ..:|:..:|..||.
pombe   148 EDILKDRDYLVANRFTIADLSFISWNNFLEIIFAEGKFSIEEEVPQLDFE-KEFPRTYSWHQRLL 211

  Fly   195 KLPYYK 200
            ..|..|
pombe   212 ARPASK 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 25/57 (44%)
GstA 8..197 CDD:223698 59/196 (30%)
GST_C_Delta_Epsilon 94..210 CDD:198287 31/127 (24%)
gst1NP_588298.1 GST_N_Ure2p_like 3..84 CDD:239346 28/61 (46%)
GstA 5..218 CDD:223698 61/201 (30%)
GST_C_Ure2p 96..219 CDD:198326 31/127 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I3221
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I1854
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm9258
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.