DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and GstT2

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster


Alignment Length:227 Identity:69/227 - (30%)
Similarity:105/227 - (46%) Gaps:15/227 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SSGIVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFI 67
            |..|..|...|||..|.:.:.||..|...||..:.|:..|.|::||.|.|....||.:......:
  Fly     2 SKPIRFYYDLLSPIARGLWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFHL 66

  Fly    68 WDSHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWI---NGVTEVP 129
            .::.||..||.||....::||||.|..||.|::.|.:....|..:.:...|..|:   ||:...|
  Fly    67 SETIAIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPMNGIAPKP 131

  Fly   130 -----QEKLDAVHQGLKLLETFLGNSPYLAGDSLTLADLSTGPTVSAVP-AAVDIDPATYPKVTA 188
                 |..::.|...|.|||.....:.:|.|.:||:||:.....::.:. ....:|...:|||..
  Fly   132 KPEQIQALIEGVENNLGLLERLWLENDFLVGKNLTMADILGSSEINQLRLCQYRVDEKKFPKVVK 196

  Fly   189 WLD--RLNKLPYYKE----INEAPAQSYVAFL 214
            ||:  |::..||:.|    |:....||..|.|
  Fly   197 WLERVRVSANPYHDEGLTFIDRKSKQSTAAKL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 24/72 (33%)
GstA 8..197 CDD:223698 59/199 (30%)
GST_C_Delta_Epsilon 94..210 CDD:198287 34/130 (26%)
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 25/74 (34%)
GstA 7..202 CDD:223698 58/194 (30%)
GST_C_family 93..218 CDD:295467 33/124 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460093
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
65.750

Return to query results.
Submit another query.