DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and Clic5

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_006524198.1 Gene:Clic5 / 224796 MGIID:1917912 Length:485 Species:Mus musculus


Alignment Length:179 Identity:47/179 - (26%)
Similarity:61/179 - (34%) Gaps:57/179 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHAIAAYLVDKY 81
            |.||.|..|..:|.      ||..|.|             .|.|..||....|.:.|..:|.:  
Mouse   285 VTTVDLKRKPADLH------NLAPGTH-------------PPFLTFNGDVKTDVNKIEEFLEE-- 328

  Fly    82 AKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEVPQEKLDAVHQG----LKL 142
            ..:.|.|||..||....|.......|...|.|.|..            |:...|:.:|    |:.
Mouse   329 TLTPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTK------------QQNNAALERGLTKALRK 381

  Fly   143 LETFLGNSP-------------------YLAGDSLTLADLSTGPTVSAV 172
            |:.:| |||                   :|.||.|||||.:..|.:..|
Mouse   382 LDDYL-NSPLPEEIDTNTHGDEKGSQRKFLDGDELTLADCNLLPKLHVV 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 17/61 (28%)
GstA 8..197 CDD:223698 47/179 (26%)
GST_C_Delta_Epsilon 94..210 CDD:198287 25/102 (25%)
Clic5XP_006524198.1 O-ClC 248..483 CDD:129941 47/179 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844840
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.