DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and Clic6

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_766057.1 Gene:Clic6 / 209195 MGIID:2146607 Length:596 Species:Mus musculus


Alignment Length:232 Identity:52/232 - (22%)
Similarity:77/232 - (33%) Gaps:85/232 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHAIAAYLVDK- 80
            |.||.|..|..:|.      ||..|         .||    |.:..:|....|.:.|..:|.:| 
Mouse   398 VTTVDLKRKPADLQ------NLAPG---------TNP----PFMTFDGEVKTDVNKIEEFLEEKL 443

  Fly    81 ----YAKSDELYPKD-------LAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEVPQEKLD 134
                |.|....:|:.       .||.:...:....||:.||..  |:.|                
Mouse   444 VPPRYPKLGTQHPESNSAGNDVFAKFSAFIKNTKKDANEIYEK--NLLR---------------- 490

  Fly   135 AVHQGLKLLETFLGNSP-------------------YLAGDSLTLADLSTGPTVSAVPAAV---- 176
                .||.|:::| |||                   :|.||.|||||.:..|.:..:....    
Mouse   491 ----ALKKLDSYL-NSPLPDEIDADSSEDVTVSQRKFLDGDELTLADCNLLPKLHIIKIVAKKYR 550

  Fly   177 DID-PATYPKVTAWLDR-------LNKLPYYKEINEA 205
            |.: |:....:..:|:.       .|..|..:||..|
Mouse   551 DFEFPSEMTGIWRYLNNAYARDEFTNTCPADREIEHA 587

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 16/61 (26%)
GstA 8..197 CDD:223698 48/222 (22%)
GST_C_Delta_Epsilon 94..210 CDD:198287 31/143 (22%)
Clic6NP_766057.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..360
PHA02664 <69..167 CDD:177447
GST_N_CLIC 360..448 CDD:239359 17/68 (25%)
O-ClC 363..596 CDD:129941 52/232 (22%)
GST_C_CLIC6 455..594 CDD:198334 33/156 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844591
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.