DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and gst-29

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_497118.1 Gene:gst-29 / 190225 WormBaseID:WBGene00001777 Length:209 Species:Caenorhabditis elegans


Alignment Length:174 Identity:44/174 - (25%)
Similarity:74/174 - (42%) Gaps:26/174 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFD 105
            |:...|:...|.|...||:|..:|..|..|.||..||.:|:..:.:...:.....|||:|  |.|
 Worm    37 GDGTWEKLKDKTPFGQVPVLYVDGFEIPQSAAIIRYLANKFGYAGKTPEEQAWADAIVDQ--FKD 99

  Fly   106 ASVIY-------------ASIANVSRPFWINGVTEVPQEKLDAVHQGL-KLLETFLGNSPYLAGD 156
            ...::             ..||.|:        :||.....|:..:.: .|||.  ..|.:|.||
 Worm   100 FMSLFREFKLAQKAGKSDVEIAKVA--------SEVAIPARDSYFEIITNLLEK--SKSGFLVGD 154

  Fly   157 SLTLADLSTGPTVSAVPAAVDIDPATYPKVTAWLDRLNKLPYYK 200
            .||.||:....:::.:......|.:.:||:.|..:::..:|..|
 Worm   155 GLTFADIVVVESLTNLEKVHFFDASEHPKLAALREKIYAIPAIK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 14/37 (38%)
GstA 8..197 CDD:223698 42/169 (25%)
GST_C_Delta_Epsilon 94..210 CDD:198287 29/121 (24%)
gst-29NP_497118.1 GST_N_Sigma_like 4..74 CDD:239337 13/36 (36%)
PTZ00057 6..209 CDD:173353 44/174 (25%)
GST_C_Sigma_like 85..191 CDD:198301 27/117 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.