DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and gst-14

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_496861.1 Gene:gst-14 / 185409 WormBaseID:WBGene00001762 Length:210 Species:Caenorhabditis elegans


Alignment Length:202 Identity:50/202 - (24%)
Similarity:84/202 - (41%) Gaps:23/202 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVK---KNPQHTVPMLDDNGTFIWDSHAIAAYLVDK 80
            :.:|...:..:.:|.:.||.     |.:.:.|   |.|...:|:|..:...|..|.||..||..|
 Worm    17 SARLLFHLAGVPFEDERVNF-----LDDTWEKMKGKTPMGQLPVLTVDDFEIPQSAAINRYLARK 76

  Fly    81 YAKSDELYPKDLAKRAIVNQRLFFDA---SVIYASIANVSRPFWINGVTEVPQEKLDAVHQGLK- 141
            :..:.:...::....|:|:|...|.|   .::.|.....|.........||.:..:|...:.|. 
 Worm    77 FGFAGKTPEEEAWVDAVVDQFKDFFAEFRKLVIAKRVGKSAEELEKLTAEVIKPAMDVYFKVLNG 141

  Fly   142 LLETFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDPA-TYPKVTAWLDRLNKLPYYKEINEA 205
            |||.  ..|.||.|||:|.|||.....:..:.....::.: ..||:.|.|:::...|..|     
 Worm   142 LLEK--SKSGYLIGDSITFADLYIADNIQTLKKYGLLEASGEQPKLAAHLEKVYSHPNLK----- 199

  Fly   206 PAQSYVA 212
               ||:|
 Worm   200 ---SYIA 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 16/62 (26%)
GstA 8..197 CDD:223698 45/185 (24%)
GST_C_Delta_Epsilon 94..210 CDD:198287 30/120 (25%)
gst-14NP_496861.1 GST_N_Sigma_like 4..75 CDD:239337 16/62 (26%)
PTZ00057 6..205 CDD:173353 50/202 (25%)
GST_C_Sigma_like 85..192 CDD:198301 28/108 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.