DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and gst-24

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_496859.1 Gene:gst-24 / 185407 WormBaseID:WBGene00001772 Length:209 Species:Caenorhabditis elegans


Alignment Length:208 Identity:49/208 - (23%)
Similarity:84/208 - (40%) Gaps:8/208 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHA 72
            ||..:|.......:...|:.::::|  :|.::.|.........|.|...:|.|..:|..|..|.|
 Worm     6 LYYFNLRGWAEPARQLFKLAHVEFE--DVRIENGTPEWGALKPKTPFGQLPFLSVDGFEIPQSAA 68

  Fly    73 IAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEVPQEKL-DAV 136
            |..||..|:..:.:...::....|||:|  |.|.......:....|......:..:.:|.. .|.
 Worm    69 ILRYLAKKFGYAGKTSEEEAWVDAIVDQ--FKDFVTPLRQLIMAQRSGNAEEIERIQKEVFAPAR 131

  Fly   137 HQGLKLLETFL--GNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDP-ATYPKVTAWLDRLNKLPY 198
            ....|:|...|  ..|.:|.||.:|.|||.....::.:......|. ....|:.|..:::|::|.
 Worm   132 DTFFKILNGILEKSKSGFLVGDGVTWADLVIADILTTMEMLGVFDKHGEEQKLAALREKVNEIPE 196

  Fly   199 YKEINEAPAQSYV 211
            .||.|.:...|.|
 Worm   197 IKEHNSSRPDSVV 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 18/70 (26%)
GstA 8..197 CDD:223698 43/192 (22%)
GST_C_Delta_Epsilon 94..210 CDD:198287 28/119 (24%)
gst-24NP_496859.1 GST_N_Sigma_like 4..75 CDD:239337 18/70 (26%)
PTZ00057 6..208 CDD:173353 47/205 (23%)
GST_C_Sigma_like 85..191 CDD:198301 23/107 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.