DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and gst-44

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_507142.2 Gene:gst-44 / 184405 WormBaseID:WBGene00001792 Length:254 Species:Caenorhabditis elegans


Alignment Length:212 Identity:43/212 - (20%)
Similarity:79/212 - (37%) Gaps:38/212 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLD--DNGTFIWDS 70
            :|.....|..:...:...|..:..|...:|||   ...:.|..||.:..||.|:  :....:.:|
 Worm    29 IYSMRFCPAAQRALIYASVKKIPSEVININLQ---QKPDWYFTKNYKGQVPTLEHAEGKKLVIES 90

  Fly    71 HAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDA---------SVIYASIANVSRPFWINGVT 126
            ..|..||.|.:.:: ::.|.|..::  |.|:|..:.         ..::.:|.|          .
 Worm    91 AVIPEYLDDIFPET-KILPSDPYEK--VQQKLLLERLSDQLTPAFGRVFRAIKN----------P 142

  Fly   127 EVPQEKLDAVHQGLKLLETFLGNSPYLAGDSLTLADLSTGPTVSAV----------PAAVDIDPA 181
            |..:||.:::.:..:..|:.|..:.|....|....|....|:...|          |...|..|.
 Worm   143 EELKEKFESILKAFEEAESLLEGAFYSGTSSPGFVDYLIYPSFQRVYWLTFLLEIFPLPSDNFPG 207

  Fly   182 T-YPKVTAWLDRLNKLP 197
            . |||::.|...:..:|
 Worm   208 PGYPKLSQWFKAITAIP 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 17/72 (24%)
GstA 8..197 CDD:223698 42/210 (20%)
GST_C_Delta_Epsilon 94..210 CDD:198287 23/124 (19%)
gst-44NP_507142.2 Thioredoxin_like 8..98 CDD:294274 16/71 (23%)
GstA 29..229 CDD:223698 43/212 (20%)
GST_C_family 112..245 CDD:295467 23/125 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.71939 Normalized mean entropy S4834
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.