DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and gst-42

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_509962.1 Gene:gst-42 / 183911 WormBaseID:WBGene00001790 Length:214 Species:Caenorhabditis elegans


Alignment Length:215 Identity:70/215 - (32%)
Similarity:96/215 - (44%) Gaps:32/215 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSSGIVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKK----NPQHTVPMLD 61
            ||:...|||....|.|...|::.|.:.|:|||||.|:|     ||||...|    ||...||...
 Worm     1 MSNQKPVLYSYWRSSCSWRVRIALALKNVDYEYKTVDL-----LSEEAKSKLKEINPAAKVPTFV 60

  Fly    62 DNGTFIWDSHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVT 126
            .:|..|.:|.||..||.:.: ....|.|||..|||        .|..|...:|:..:|.....|.
 Worm    61 VDGQVITESLAIIEYLEETH-PDVPLLPKDPIKRA--------HARAISLLVASGIQPLHNLKVL 116

  Fly   127 EVPQEK---------LDAVHQGLKLLETFL--GNSPYLAGDSLTLADLSTGPTV-SAVPAAVDID 179
            ::..:|         ...|.:||..||..|  .:..|..||.:|:||||..|.: ||....:|:.
 Worm   117 QLLNKKEAGFGGQFAKQFVVEGLTALEILLKQHSGKYAVGDDVTIADLSIPPLIYSANRFNLDLS 181

  Fly   180 PATYPKVTAWLDRLNKLPYY 199
            |  ||.|....:.|..:|.:
 Worm   182 P--YPTVNRINETLADIPAF 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 31/76 (41%)
GstA 8..197 CDD:223698 66/204 (32%)
GST_C_Delta_Epsilon 94..210 CDD:198287 33/118 (28%)
gst-42NP_509962.1 GST_N_Zeta 6..77 CDD:239340 30/75 (40%)
maiA 7..211 CDD:273527 68/209 (33%)
GST_C_Zeta 90..207 CDD:198300 33/120 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.