DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and C25H3.7

DIOPT Version :10

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001254102.1 Gene:C25H3.7 / 173961 WormBaseID:WBGene00016116 Length:275 Species:Caenorhabditis elegans


Alignment Length:171 Identity:33/171 - (19%)
Similarity:53/171 - (30%) Gaps:72/171 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 AAIIDEKIFCCHGGLSPDLNHMEQIKRIMRPTDVPDTGLLCDLLWSDPDK--DVKGWGENDRGVS 223
            |.|:..:|...||.||                           .|::|||  :|:..|:.:..:.
 Worm    63 ARILQARISEIHGRLS---------------------------YWTEPDKINNVEHLGQLEISIR 100

  Fly   224 FTFGVDIVAKFLLIHELDLICRAHQVVEDGYEFFARRSLVTLFSAPNYCGEFDNAGGMMSVDANL 288
                          ..||.: |||:      |.|.::.........|:..::..           
 Worm   101 --------------QSLDQL-RAHK------EHFGQQQQAMQIENANFVKDWST----------- 133

  Fly   289 MCSFQ--ILKPSEKKAKYQ----YSGTNN----QRPQTPQR 319
             ||.|  |..|.|::.:..    .|.|.|    :....|||
 Worm   134 -CSMQDGIQIPLEQQLQSMSWILNSNTTNIVTEEHNSIPQR 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GstA 6..201 CDD:440390 7/39 (18%)
C25H3.7NP_001254102.1 GST_N_Metaxin_like 39..115 CDD:239378 20/99 (20%)
GST_C_Metaxin 194..265 CDD:198302
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.