DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and GSTO2

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_899062.1 Gene:GSTO2 / 119391 HGNCID:23064 Length:243 Species:Homo sapiens


Alignment Length:222 Identity:44/222 - (19%)
Similarity:89/222 - (40%) Gaps:45/222 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNG-TFIWD 69
            |.:|.....|.....:|.||..::.:|...:||:   :..|.|..|:|...:|:|:.:. ..|::
Human    24 IRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLR---NKPEWYYTKHPFGHIPVLETSQCQLIYE 85

  Fly    70 SHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWI-----NGVTEVP 129
            |.....||.|.| ...:|:|.|..:||  .|::..:   ::..:.::::...:     ...|.:.
Human    86 SVIACEYLDDAY-PGRKLFPYDPYERA--RQKMLLE---LFCKVPHLTKECLVALRCGRECTNLK 144

  Fly   130 QEKLDAVHQGLKLLETFL--GNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDPATYPKVTAWLDR 192
            .    |:.|....||..|  .|:.:..|..:::.|....|                     |.:|
Human   145 A----ALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWP---------------------WFER 184

  Fly   193 LNKLPYYKEINEAPA-QSYVAFLRSKW 218
            |:.......::..|| :.:::.:  ||
Human   185 LDVYGILDCVSHTPALRLWISAM--KW 209

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 19/73 (26%)
GstA 8..197 CDD:223698 39/196 (20%)
GST_C_Delta_Epsilon 94..210 CDD:198287 18/123 (15%)
GSTO2NP_899062.1 Thioredoxin_like 7..94 CDD:320948 18/72 (25%)