DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and Gsto1

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001007603.1 Gene:Gsto1 / 114846 RGDID:70952 Length:241 Species:Rattus norvegicus


Alignment Length:210 Identity:47/210 - (22%)
Similarity:85/210 - (40%) Gaps:53/210 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDD-NGTFIWD 69
            |.:|.....|..:...:.||...:.:|...:||   ::..|.:.:|||...||:|:: .|..|.:
  Rat    24 IRVYSMRFCPFAQRTLMVLKAKGIRHEIININL---KNKPEWFFEKNPFGLVPVLENTQGHLITE 85

  Fly    70 SHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEVPQEKLD 134
            |.....||.:.|.:. :|:|.|..::|.  |::.|:   :::.:.::        ||...:.|..
  Rat    86 SVITCEYLDEAYPEK-KLFPDDPYEKAC--QKMTFE---LFSKVPSL--------VTSFIRAKRK 136

  Fly   135 AVHQGLK--------LLETFLG--NSPYLAGDSLTLADLSTGPTVSAVPAAVDIDPATYPKVTAW 189
            ..|.|:|        .||..:.  .:.:..|:||::.|....|                     |
  Rat   137 EDHPGIKEELKKEFSKLEEAMAKKRTAFFGGNSLSMIDYLIWP---------------------W 180

  Fly   190 LDRLNKLPYYKEINE 204
            ..||..|    |:||
  Rat   181 FQRLEAL----ELNE 191

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 20/73 (27%)
GstA 8..197 CDD:223698 42/199 (21%)
GST_C_Delta_Epsilon 94..210 CDD:198287 23/121 (19%)
Gsto1NP_001007603.1 GST_N_Omega 5..94 CDD:239353 19/72 (26%)
GstA 26..214 CDD:223698 46/208 (22%)