DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and Clic1

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_254279.1 Gene:Clic1 / 114584 MGIID:2148924 Length:241 Species:Mus musculus


Alignment Length:163 Identity:36/163 - (22%)
Similarity:64/163 - (39%) Gaps:33/163 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLYGTDLSPCVRTVKLTLKVLNLDYEY-KEVNLQAGEHLS--------EEYVKKNPQHTVPMLDD 62
            :||||::......::..|:.:.....| |...|....:.|        ..|:|    ::.|.|:|
Mouse    67 LLYGTEVHTDTNKIEEFLEAMLCPPRYPKLAALNPESNTSGLDIFAKFSAYIK----NSNPALND 127

  Fly    63 NGTFIWDSHAIAAYLVDKYAKS------DELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFW 121
            |   :......|..::|.|..|      ||...:|..    ::||.|.|.:.:..:..|:.....
Mouse   128 N---LEKGLLKALKVLDNYLTSPLPEEVDETSAEDEG----ISQRKFLDGNELTLADCNLLPKLH 185

  Fly   122 INGVTEVPQEKLDAVHQGLKLLETFLGNSPYLA 154
            |   .:|..:|    ::|..:.|.|.|...||:
Mouse   186 I---VQVVCKK----YRGFTIPEAFRGVHRYLS 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 16/80 (20%)
GstA 8..197 CDD:223698 36/162 (22%)
GST_C_Delta_Epsilon 94..210 CDD:198287 14/61 (23%)
Clic1NP_254279.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..90 5/22 (23%)
O-ClC 6..241 CDD:129941 36/163 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844826
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.