DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and vars1

DIOPT Version :10

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001298275.1 Gene:vars1 / 114427 ZFINID:ZDB-GENE-010601-1 Length:1271 Species:Danio rerio


Alignment Length:146 Identity:38/146 - (26%)
Similarity:66/146 - (45%) Gaps:14/146 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 GTFIWDSHAIAAYL--VDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRP-FWINGV 125
            ||.:..:.|::.||  ..|.|.||:      .:.:.|.|.|.|..:.:......|:.| ..|.||
Zfish    54 GTVLSGTSAVSWYLAATGKRAGSDK------KQESQVWQWLSFAENELTPVACAVAFPLLGIMGV 112

  Fly   126 TEVPQEKLDA-VHQGLKLLETFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDPA---TYPKV 186
            .:..|:...| :.:.||.|:..|....:|.|:|:||||.:.. ..:.:|....::||   :...|
Zfish   113 DKKLQQSSRAELLRVLKALDGTLALRTFLVGESVTLADAAVA-MAALLPFKYALEPADRKSLVNV 176

  Fly   187 TAWLDRLNKLPYYKEI 202
            |.|.:.....|.:.::
Zfish   177 TRWFNTCVNQPQFLKV 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GstA 6..201 CDD:440390 38/143 (27%)
vars1NP_001298275.1 GST_C_ValRS_N 80..202 CDD:198327 29/114 (25%)
PTZ00419 291..1270 CDD:240411
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.