DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and LOC100333907

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_009303556.1 Gene:LOC100333907 / 100333907 -ID:- Length:249 Species:Danio rerio


Alignment Length:241 Identity:51/241 - (21%)
Similarity:86/241 - (35%) Gaps:64/241 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GTDLSPCVRTVKLTL---------KVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGT 65
            |..|..|..:.:|.:         .|..:|.:.|..:||          ...|....|.:..||.
Zfish    26 GESLGNCPFSQRLFMILWLKGVIFNVTTVDLKRKPADLQ----------DLAPGTNPPFMTFNGE 80

  Fly    66 FIWDSHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASV-IYASIANVSRPFWINGVTEVP 129
            .:.|.:.|..:|.::.....  |||...|....|     .|.: ::|..:     .:|....:..
Zfish    81 VLVDVNKIEEFLEERLGPPQ--YPKLATKHPESN-----TAGIDVFAKFS-----AYIKNPRKEA 133

  Fly   130 QEKLD-AVHQGLKLLETFL------------------GNSPYLAGDSLTLADLSTGPTVSAVP-- 173
            .|.|: |:.:.||.|:.:|                  ....:|.||.|||||.:..|.:..:.  
Zfish   134 NEGLEKALLKSLKRLDEYLQTPLPEEIDADSLEDPGASTRSFLDGDELTLADCNLLPKLHIIKIV 198

  Fly   174 ----AAVDIDPATYPKVTAWLDRLNKLPYYKE--INEAPAQSYVAF 213
                ..::| ||....:..:|::    .|.:|  ||..||...:.|
Zfish   199 ARKYRGLEI-PAEMSGIWRYLNK----AYQREEFINTCPADREIQF 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 16/77 (21%)
GstA 8..197 CDD:223698 44/221 (20%)
GST_C_Delta_Epsilon 94..210 CDD:198287 31/143 (22%)
LOC100333907XP_009303556.1 O-ClC 14..249 CDD:129941 51/241 (21%)
GST_N_CLIC 14..101 CDD:239359 16/86 (19%)
GST_C_family 108..248 CDD:295467 31/147 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589518
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.