DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE1 and gstz1

DIOPT Version :9

Sequence 1:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_002938913.1 Gene:gstz1 / 100145591 XenbaseID:XB-GENE-978910 Length:216 Species:Xenopus tropicalis


Alignment Length:206 Identity:67/206 - (32%)
Similarity:101/206 - (49%) Gaps:25/206 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNL--QAGEHLSEEYVKKNPQHTVPMLDDNGTFIWD 69
            :|||...|.|...|::.|....::|:.:.:||  ..|..||.||.:.||...||.|..:|..:..
 Frog     8 LLYGYFRSSCSWRVRIALAFKGIEYDQQVINLVKDGGMQLSNEYKQVNPMQQVPALCIDGVTLSQ 72

  Fly    70 SHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFW-INGVTEVPQEKL 133
            |.||..|| ::...:..|.|:|..|||.|  |:..|      .||:..:|.. :..:.::.:.||
 Frog    73 SLAIIEYL-EETRPNPPLLPRDPKKRAQV--RMISD------QIASGIQPLQNLCVLQKIGETKL 128

  Fly   134 D-AVH------QGL-KLLETFLGNSPYLAGDSLTLADLSTGPTV-SAVPAAVDIDPATYPKVTAW 189
            : |.|      |.| |||:|..|.  |..||.:|:|||...|.| :||...||:.|  ||.:...
 Frog   129 EWAKHFITRGFQALEKLLQTTAGR--YCVGDEVTIADLCLVPQVANAVRFKVDLAP--YPTIVGI 189

  Fly   190 LDRLNKLPYYK 200
            .:.|.:|..::
 Frog   190 NESLLQLEAFQ 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 26/73 (36%)
GstA 8..197 CDD:223698 66/200 (33%)
GST_C_Delta_Epsilon 94..210 CDD:198287 38/117 (32%)
gstz1XP_002938913.1 maiA 8..211 CDD:273527 67/206 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.