DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and Clic5

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_446055.1 Gene:Clic5 / 94272 RGDID:620659 Length:251 Species:Rattus norvegicus


Alignment Length:179 Identity:33/179 - (18%)
Similarity:59/179 - (32%) Gaps:74/179 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 VNKYAQ------SDELYPKDPLKRAVVDQRLHFETGVLFHGIFKQ---------------LQRAL 119
            |||..:      :.|.|||...:        |.|:......||.:               |:|.|
  Rat    85 VNKIEEFLEETLTPEKYPKLAAR--------HRESNTAGIDIFSKFSAYIKNTKQQNNAALERGL 141

  Fly   120 FK-----ENATEVPKDRLAELKDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVD 179
            .|     ::....|   |.|..|.....::..::..::.|.:||:||.:::              
  Rat   142 TKALRKLDDYLNTP---LPEEIDTNTHGDEKGSQRKFLDGDELTLADCNLL-------------- 189

  Fly   180 ATKYPKLSAWLARISALPFYEEDNLRGARLLADKIRS-KLPKQFDKLWQ 227
                |||..                  .:::|.|.|: .:|.:...||:
  Rat   190 ----PKLHV------------------VKIVAKKYRNYDIPAEMTGLWR 216

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 27/146 (18%)