DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and CLIC3

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_004660.2 Gene:CLIC3 / 9022 HGNCID:2064 Length:236 Species:Homo sapiens


Alignment Length:242 Identity:55/242 - (22%)
Similarity:83/242 - (34%) Gaps:81/242 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PPVRAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRK-NPQHTVPMLEDGESCIWDSHAIIGYLV 76
            |..:.:.:.|....:.....|:|.:.    .||:|:. .|...:|:|      ::||.|....|.
Human    23 PSCQRLFMVLLLKGVPFTLTTVDTRR----SPDVLKDFAPGSQLPIL------LYDSDAKTDTLQ 77

  Fly    77 NKYAQSDELYPKDPLKRAVVDQRLHFETGVLFH---------------GIFKQLQRALFKENATE 126
            .:....:.|.|.|....|...:..:.....:||               .:::||.||        
Human    78 IEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRA-------- 134

  Fly   127 VPKDRLAELKDAY--ALLEQFLAENP--------YVAGPQLTIADFS------IVATVSTLHLSY 175
                 ||.| |:|  |.||..||..|        ::.|.:||:||.|      ||.||.. |...
Human   135 -----LARL-DSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCA-HFRQ 192

  Fly   176 CPVDATKYPKLSAWLARISALPFYEEDNLRGARLLADKIRSKLPKQF 222
            .|:.|                      .|||.|...|....:  |:|
Human   193 APIPA----------------------ELRGVRRYLDSAMQE--KEF 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 48/215 (22%)
GST_N_Delta_Epsilon 4..77 CDD:239343 14/64 (22%)
GST_C_Delta_Epsilon 91..211 CDD:198287 35/150 (23%)
CLIC3NP_004660.2 Required for insertion into the membrane. /evidence=ECO:0000250 1..88 15/74 (20%)
PLN02817 5..229 CDD:330276 55/242 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154447
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.