DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and URE2

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_014170.1 Gene:URE2 / 855492 SGDID:S000005173 Length:354 Species:Saccharomyces cerevisiae


Alignment Length:250 Identity:59/250 - (23%)
Similarity:101/250 - (40%) Gaps:53/250 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGTESSPPVRAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLED---GESCIWD 67
            |:...|:|....|.:.|..|...:....||...|:|..|:.:..||...||.|.|   ....||:
Yeast   116 LFSHRSAPNGFKVAIVLSELGFHYNTIFLDFNLGEHRAPEFVSVNPNARVPALIDHGMDNLSIWE 180

  Fly    68 SHAIIGYLVNKYAQ--------SDELYPKDPLK----------RAVVDQRLHFETGVLFHGIFKQ 114
            |.||:.:|||||.:        ||:|..:..:.          ..::.|.|||.   .||.  ::
Yeast   181 SGAILLHLVNKYYKETGNPLLWSDDLADQSQINAWLFFQTSGHAPMIGQALHFR---YFHS--QK 240

  Fly   115 LQRALFKENATEVPKDRLAELKDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVD 179
            :..|:  |..|:       |::..|.::|..|||.......:|...:.:..:..:|      |:.
Yeast   241 IASAV--ERYTD-------EVRRVYGVVEMALAERREALVMELDTENAAAYSAGTT------PMS 290

  Fly   180 ATKYPKLSAWLA----RISALPFYEEDNLRGARLLADKIRSKLPKQFDKL--WQK 228
            .:::.....||.    .|:.|.|...:|      :.|:|...:..:|.::  |.|
Yeast   291 QSRFFDYPVWLVGDKLTIADLAFVPWNN------VVDRIGINIKIEFPEVYKWTK 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 51/215 (24%)
GST_N_Delta_Epsilon 4..77 CDD:239343 23/73 (32%)
GST_C_Delta_Epsilon 91..211 CDD:198287 24/133 (18%)
URE2NP_014170.1 GST_N_Ure2p_like 114..194 CDD:239346 27/77 (35%)
GST_C_Ure2p 208..350 CDD:198326 28/157 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.