DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and GTT1

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_012304.1 Gene:GTT1 / 854856 SGDID:S000001477 Length:234 Species:Saccharomyces cerevisiae


Alignment Length:208 Identity:44/208 - (21%)
Similarity:82/208 - (39%) Gaps:32/208 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLE--DGES----CIWDSHAIIGYLV 76
            :|..|..|.|::|.......|.....|::.:.:|....|:||  |.|:    .:.:|..|..|::
Yeast    19 LLWLLDHLNLEYEIVPYKRDANFRAPPELKKIHPLGRSPLLEVQDRETGKKKILAESGFIFQYVL 83

  Fly    77 NKYAQSDELYPKDPLKRAVVDQRLHFETGVLFHGIFKQLQRALFKENATEVPKDRLA-------- 133
            ..:..|..|..:|......::..|.:..|.|...:..:...:..|::....|...||        
Yeast    84 QHFDHSHVLMSEDADIADQINYYLFYVEGSLQPPLMIEFILSKVKDSGMPFPISYLARKVADKIS 148

  Fly   134 ------ELKDAYALLE-QFLAENPYVAGPQLTIADFSIVATVSTLHLSY-----CPVDATKYPKL 186
                  |:|:.:..:| :....|.|:...:|:.||   :.....|.:::     .|.|   ||.:
Yeast   149 QAYSSGEVKNQFDFVEGEISKNNGYLVDGKLSGAD---ILMSFPLQMAFERKFAAPED---YPAI 207

  Fly   187 SAWLARISALPFY 199
            |.||..|::...|
Yeast   208 SKWLKTITSEESY 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 43/204 (21%)
GST_N_Delta_Epsilon 4..77 CDD:239343 16/64 (25%)
GST_C_Delta_Epsilon 91..211 CDD:198287 25/129 (19%)
GTT1NP_012304.1 GST_N_GTT1_like 6..87 CDD:239344 16/67 (24%)
GST_C_GTT1_like 93..218 CDD:198298 25/130 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.