DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and GSTF5

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001322019.1 Gene:GSTF5 / 839479 AraportID:AT1G02940 Length:281 Species:Arabidopsis thaliana


Alignment Length:212 Identity:53/212 - (25%)
Similarity:88/212 - (41%) Gaps:27/212 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGTESSPPVRAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLEDGESCIWDSHA 70
            :||...|...|.||..|....|.::..|:::.|||..||..|..||...||:..||...:.:|.|
plant    66 IYGYPYSTNTRRVLAVLHEKGLSYDPITVNLIAGDQKKPSFLAINPFGQVPVFLDGGLKLTESRA 130

  Fly    71 IIGYL--VNKYAQSDELYPKDPLKRAVVDQRL-----HFETGVLFHGIFKQLQRALFKENAT--- 125
            |..|:  |:|...:..|..|.  .:.:..||:     .||        |..|...|..|.:.   
plant   131 ISEYIATVHKSRGTQLLNYKS--YKTMGTQRMWMAIESFE--------FDPLTSTLTWEQSIKPM 185

  Fly   126 -------EVPKDRLAELKDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDATKY 183
                   :|..:..|:|:....:.|:.|..:.::|....|:||...:..:..|..::........
plant   186 YGLKTDYKVVNETEAKLEKVLDIYEERLKNSSFLASNSFTMADLYHLPNIQYLMDTHTKRMFVNR 250

  Fly   184 PKLSAWLARISALPFYE 200
            |.:..|:|.|:|.|.::
plant   251 PSVRRWVAEITARPAWK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 52/207 (25%)
GST_N_Delta_Epsilon 4..77 CDD:239343 25/72 (35%)
GST_C_Delta_Epsilon 91..211 CDD:198287 24/125 (19%)
GSTF5NP_001322019.1 GST_N_Phi 65..136 CDD:239351 25/69 (36%)
GST_C_Phi 153..270 CDD:198296 24/123 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.