DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and GSTF7

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_171791.1 Gene:GSTF7 / 839295 AraportID:AT1G02920 Length:209 Species:Arabidopsis thaliana


Alignment Length:208 Identity:57/208 - (27%)
Similarity:102/208 - (49%) Gaps:16/208 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MANLILYGTESSPPVRAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLEDGESCI 65
            ||.:.::|..:|...|.||:.|....||.||..::::.|:|.|...:.:||...||..|||:..:
plant     1 MAGIKVFGHPASTATRRVLIALHEKNLDFEFVHIELKDGEHKKEPFIFRNPFGKVPAFEDGDFKL 65

  Fly    66 WDSHAIIGYLVNKYA----QSDELYPKDPLKRAV-VDQRLH-FE---TGVLFHGIFKQLQRALFK 121
            ::|.||..|:.:.|:    |...|..||....|: ::...| |:   :.:::..:.|.|......
plant    66 FESRAITQYIAHFYSDKGNQLVSLGSKDIAGIAMGIEIESHEFDPVGSKLVWEQVLKPLYGMTTD 130

  Fly   122 ENATEVPKDRLAELKDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDA--TKYP 184
            :...|..:.:||::.|.|   |..|.|:.|:|..:.|:.|...:..:.  :|...|...  .:.|
plant   131 KTVVEEEEAKLAKVLDVY---EHRLGESKYLASDKFTLVDLHTIPVIQ--YLLGTPTKKLFDERP 190

  Fly   185 KLSAWLARISALP 197
            .:|||:|.|::.|
plant   191 HVSAWVADITSRP 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 54/203 (27%)
GST_N_Delta_Epsilon 4..77 CDD:239343 24/72 (33%)
GST_C_Delta_Epsilon 91..211 CDD:198287 26/114 (23%)
GSTF7NP_171791.1 GST_N_Phi 4..77 CDD:239351 24/72 (33%)
GST_C_Phi 95..209 CDD:198296 26/114 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.