DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and GSTF4

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001320441.1 Gene:GSTF4 / 838240 AraportID:AT1G02950 Length:255 Species:Arabidopsis thaliana


Alignment Length:263 Identity:58/263 - (22%)
Similarity:95/263 - (36%) Gaps:78/263 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGTESSPPVRAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLEDGESCIWDSHA 70
            ::|...|...|.||..|...:|.:|..|:.:|.|:|.....|..||...||:.|||...:::|.|
plant    39 VHGDPFSTNTRRVLAVLHEKRLSYEPITVKLQTGEHKTEPFLSLNPFGQVPVFEDGSVKLYESRA 103

  Fly    71 IIGYLVNKYAQSD-----------------------ELYPKDPLKRAVVDQRLHFETGVL-FHGI 111
            |..|:.  |..|.                       |.:..||     ...:|.:|..:. .:|:
plant   104 ITQYIA--YVHSSRGTQLLNLRSHETMATLTMWMEIEAHQFDP-----PASKLTWEQVIKPIYGL 161

  Fly   112 FKQLQRALFKENATEVPKDRLAELKDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYC 176
              :..:.:.|||.        |.|:....:.|:.|.|:.::|....|:.|..        ||   
plant   162 --ETDQTIVKENE--------AILEKVLNIYEKRLEESRFLACNSFTLVDLH--------HL--- 205

  Fly   177 PVDATKYPKLSAWLARISALPFYEEDNLRGARLLADKIRSKLPKQFDKL-----WQKAFEDIKSG 236
                   |.:. :|........:|:             |||:.|..|::     |:.|.:..||.
plant   206 -------PNIQ-YLLGTPTKKLFEK-------------RSKVRKWVDEITSREAWKMACDQEKSW 249

  Fly   237 AGK 239
            ..|
plant   250 FNK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 47/214 (22%)
GST_N_Delta_Epsilon 4..77 CDD:239343 24/70 (34%)
GST_C_Delta_Epsilon 91..211 CDD:198287 19/120 (16%)
GSTF4NP_001320441.1 GST_N_Phi 38..109 CDD:239351 24/69 (35%)
GST_C_Phi 126..243 CDD:198296 28/163 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4833
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.