DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and GSTT2

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_198940.3 Gene:GSTT2 / 834125 AraportID:AT5G41240 Length:591 Species:Arabidopsis thaliana


Alignment Length:222 Identity:57/222 - (25%)
Similarity:96/222 - (43%) Gaps:34/222 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LILYGTESSPPVRAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLEDGESCIWDS 68
            |.:|....|.|.||||:..:..::..:...:.:.....|.|:....||...||.:.||...:::|
plant     3 LKVYADRMSQPSRAVLIFCKVNEIQFDEILISLGKRQQLSPEFKEINPMGKVPAIVDGRLKLFES 67

  Fly    69 HAIIGYLVNKYAQ-SDELYPKDPLKRAVVDQRLHFE--------TGVLFHGIF-KQLQRALFKEN 123
            |||:.||.:.||. .|..||.|..|||.:...|.:.        :|.:.:.:. ..|...|..:.
plant    68 HAILIYLSSAYASVVDHWYPNDLSKRAKIHSVLDWHHTNLRPGASGYVLNSVLAPALGLPLNPKA 132

  Fly   124 ATEVPKDRLAE--LKDAYALLEQFLAENP---YVAGPQLTIADFSIVATVSTLHLSYCPVD---- 179
            |.|      ||  |.::.:.||.|..:..   .:.|.|.:|||.|:|..:..|.:    :|    
plant   133 AAE------AENILTNSLSTLETFWLKGSAKFLLGGKQPSIADLSLVCELMQLQV----LDDKDR 187

  Fly   180 ---ATKYPKLSAWL--ARISALPFYEE 201
               .:.:.|:..|:  .|.:.:|..:|
plant   188 LRLLSPHKKVEQWIESTRKATMPHSDE 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 55/216 (25%)
GST_N_Delta_Epsilon 4..77 CDD:239343 22/72 (31%)
GST_C_Delta_Epsilon 91..211 CDD:198287 29/134 (22%)
GSTT2NP_198940.3 GST_N_Theta 3..78 CDD:239348 22/74 (30%)
GST_C_Theta 92..221 CDD:198292 29/133 (22%)
NAM-associated 380..>515 CDD:405060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.