DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and GSTT1

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_198937.1 Gene:GSTT1 / 834123 AraportID:AT5G41210 Length:245 Species:Arabidopsis thaliana


Alignment Length:248 Identity:58/248 - (23%)
Similarity:102/248 - (41%) Gaps:43/248 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MANLILYGTESSPPVRAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLEDGESCI 65
            |..|.:|....|.|.|||::..:...:..:...:.:.....|.|:....||...||.:.||...:
plant     1 MMKLKVYADRMSQPSRAVIIFCKVNGIQFDEVLISLAKRQQLSPEFKDINPLGKVPAIVDGRLKL 65

  Fly    66 WDSHAIIGYLVNKY-AQSDELYPKDPLKRAVVDQRLHFETGVLFHGIFKQLQRALFKENATEVPK 129
            ::||||:.||.:.: :.:|..||.|..|||.:...|.:....|..|      .|.:..|:...|.
plant    66 FESHAILIYLSSAFPSVADHWYPNDLSKRAKIHSVLDWHHTNLRRG------AAGYVLNSVLGPA 124

  Fly   130 DRLAELKDAYALLEQFLAEN-------------PYVAGP-QLTIADFSIVATVSTLHLSYCPVD- 179
            ..|.....|.|..||.|.::             .::.|. |.:|||.|:|..:..|.:    :| 
plant   125 LGLPLNPKAAAEAEQLLTKSLSTLETFWLKGNAKFLLGSNQPSIADLSLVCELMQLQV----LDD 185

  Fly   180 ------ATKYPKLSAWL--ARISALPFYEEDNLRGARLLADKIRSKLPKQFDK 224
                  .:.:.|:..|:  .:.:.:|.::|.:         :|..|:.:.|.|
plant   186 KDRLRLLSTHKKVEQWIENTKKATMPHFDETH---------EILFKVKEGFQK 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 51/216 (24%)
GST_N_Delta_Epsilon 4..77 CDD:239343 21/72 (29%)
GST_C_Delta_Epsilon 91..211 CDD:198287 28/142 (20%)
GSTT1NP_198937.1 GST_N_Theta 4..79 CDD:239348 21/74 (28%)
GST_C_Theta 93..223 CDD:198292 29/148 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.