DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and GSTF11

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_186969.1 Gene:GSTF11 / 821227 AraportID:AT3G03190 Length:214 Species:Arabidopsis thaliana


Alignment Length:214 Identity:61/214 - (28%)
Similarity:91/214 - (42%) Gaps:29/214 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGTESSPPVRAVLLTLRALQLDHEFHTL--DMQAGDHLKPDMLRKNPQHTVPMLEDGESCIWDS 68
            :||...:...:.|||..  |:.|.||..:  |:...:..||..|.:.|...||.:|||...:::|
plant     5 VYGQIKAANPQRVLLCF--LEKDIEFEVIHVDLDKLEQKKPQHLLRQPFGQVPAIEDGYLKLFES 67

  Fly    69 HAIIGYLVNKYA-QSDELYPKDPLKRAVVDQRLHFETGVLFHGIFKQLQRALFKENA-------- 124
            .||..|...||| |..:|..|....||:|||.:..|....:......:...:||..:        
plant    68 RAIARYYATKYADQGTDLLGKTLEGRAIVDQWVEVENNYFYAVALPLVMNVVFKPKSGKPCDVAL 132

  Fly   125 TEVPKDRLAELKDAYALLEQFLAENPYVAGPQLTIADFS-------IVATVSTLHLSYCPVDATK 182
            .|..|.:..::.|.|   |..||.|.|:.|.:.|:||.|       |:...|...|      .|.
plant   133 VEELKVKFDKVLDVY---ENRLATNRYLGGDEFTLADLSHMPGMRYIMNETSLSGL------VTS 188

  Fly   183 YPKLSAWLARISALPFYEE 201
            ...|:.|...|||.|.:::
plant   189 RENLNRWWNEISARPAWKK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 60/208 (29%)
GST_N_Delta_Epsilon 4..77 CDD:239343 23/72 (32%)
GST_C_Delta_Epsilon 91..211 CDD:198287 32/126 (25%)
GSTF11NP_186969.1 PLN02473 1..214 CDD:166114 61/214 (29%)
GST_N_Phi 2..77 CDD:239351 23/73 (32%)
GST_C_Phi 91..209 CDD:198296 32/126 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.