DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and GSTF10

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_180644.1 Gene:GSTF10 / 817637 AraportID:AT2G30870 Length:215 Species:Arabidopsis thaliana


Alignment Length:214 Identity:58/214 - (27%)
Similarity:102/214 - (47%) Gaps:26/214 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LILYGTESSPPVRAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLEDGESCIWDS 68
            |.:|....:...||| :||....:..|...:|:..|:..:|:.|...|...:|:|.||:..|::|
plant     3 LTIYAPLFASSKRAV-VTLVEKGVSFETVNVDLMKGEQRQPEYLAIQPFGKIPVLVDGDYKIFES 66

  Fly    69 HAIIGYLVNKY-AQSDELYPKDPLKRAVVDQRLHFET--------GVLFHGIFKQLQRALFKENA 124
            .||:.|:..|| :|..:|..|...:|..|:|.|..|.        .:..:.:|..|......|..
plant    67 RAIMRYIAEKYRSQGPDLLGKTIEERGQVEQWLDVEATSYHPPLLALTLNIVFAPLMGFPADEKV 131

  Fly   125 TEVPKDRLAELKDAYALLEQFLAENPYVAGPQLTIADFS-------IVATVSTLHLSYCPVDATK 182
            .:..:::|||:.|.|   |..|::|.|:||..:::||.:       :|..:...||    :...|
plant   132 IKESEEKLAEVLDVY---EAQLSKNEYLAGDFVSLADLAHLPFTEYLVGPIGKAHL----IKDRK 189

  Fly   183 YPKLSAWLARISALPFYEE 201
            :  :|||..:||:...::|
plant   190 H--VSAWWDKISSRAAWKE 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 57/208 (27%)
GST_N_Delta_Epsilon 4..77 CDD:239343 22/72 (31%)
GST_C_Delta_Epsilon 91..211 CDD:198287 31/126 (25%)
GSTF10NP_180644.1 PLN02395 1..215 CDD:166036 58/214 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4833
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.