DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and GDAP1L1

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001243666.1 Gene:GDAP1L1 / 78997 HGNCID:4213 Length:386 Species:Homo sapiens


Alignment Length:258 Identity:60/258 - (23%)
Similarity:100/258 - (38%) Gaps:58/258 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NLILYGTESSPPVRAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLEDGESCIWD 67
            :|:||....|...:.|.|.:....|..|...:.:...:|.:|..:|.|....||::...::.|.|
Human    46 SLVLYHWTQSFSSQKVRLVIAEKGLVCEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISD 110

  Fly    68 SHAIIGYLVNKY-----AQSDELYPKDPLKRAVVDQR---LHFETGVLFHGIFKQLQRALFKENA 124
            ...||.|:...:     .:....:|..||  ||..:.   |..|.|.|.|.  :.||   ::|..
Human   111 YDQIIDYVERTFTGGGRGRCPSGFPAQPL--AVPTEHVVALMPEVGSLQHA--RVLQ---YRELL 168

  Fly   125 TEVPKDRLAELKDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTL----HLSYCPVDATKY-- 183
            ..:|       .|||.        :..:..|:||..  |::...:|.    ||:....|..|.  
Human   169 DALP-------MDAYT--------HGCILHPELTTD--SMIPKYATAEIRRHLANATTDLMKLDH 216

  Fly   184 ---PKLS-AWLARISAL--PFYEEDN-------LRGARLLADKIRSKLPK-------QFDKLW 226
               |:|| .:|::...|  ...|.|:       |....::.|:|.::|.|       |..:||
Human   217 EEEPQLSEPYLSKQKKLMAKILEHDDVSYLKKILGELAMVLDQIEAELEKRKLENEGQKCELW 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 50/212 (24%)
GST_N_Delta_Epsilon 4..77 CDD:239343 19/72 (26%)
GST_C_Delta_Epsilon 91..211 CDD:198287 32/141 (23%)
GDAP1L1NP_001243666.1 GstA 47..333 CDD:223698 60/257 (23%)
GST_N_GDAP1 47..119 CDD:239350 19/71 (27%)
GST_C_GDAP1L1 220..330 CDD:198335 15/60 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154525
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.