DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and Gstm7

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_006502034.1 Gene:Gstm7 / 68312 MGIID:1915562 Length:225 Species:Mus musculus


Alignment Length:170 Identity:42/170 - (24%)
Similarity:74/170 - (43%) Gaps:23/170 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VPMLEDGESCIWDSHAIIGYLVNKY----AQSDELYPKDPLKRAVVDQRLHFETGVLFHGIFKQL 115
            :|.|.||...|..|:||:.||..|:    ...:|....|.|:..::|.|:             .|
Mouse    67 LPYLIDGSHKITQSNAILRYLGRKHNLCGETEEERIRVDILENQLMDNRM-------------VL 118

  Fly   116 QRALFKENATEVPKDRLAELKDAYALLEQFLAENPYVAGPQLTIADFSI--VATVSTLHLSYCPV 178
            .|..:..:..::....|.:|.....|..:||.:.|:.||.::|..||..  |...:.:..:.| :
Mouse   119 ARLCYNADFEKLKPGYLEQLPGMMRLYSEFLGKRPWFAGDKITFVDFIAYDVLERNQVFEAKC-L 182

  Fly   179 DATKYPKLSAWLARISALPFYEEDNLRGARLLADKIRSKL 218
            ||  :|.|..::||...|... .|.::.:|.|...:.:|:
Mouse   183 DA--FPNLKDFIARFEGLKKI-SDYMKTSRFLPRPMFTKM 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 37/147 (25%)
GST_N_Delta_Epsilon 4..77 CDD:239343 10/21 (48%)
GST_C_Delta_Epsilon 91..211 CDD:198287 27/121 (22%)
Gstm7XP_006502034.1 GST_N_Mu 20..91 CDD:239373 10/23 (43%)
GST_C_Mu 99..219 CDD:198318 30/136 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D522554at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.