DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and Gstm3l

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_065415.1 Gene:Gstm3l / 57298 RGDID:620381 Length:218 Species:Rattus norvegicus


Alignment Length:179 Identity:41/179 - (22%)
Similarity:72/179 - (40%) Gaps:37/179 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VPMLEDGESCIWDSHAIIGYLVNKY----AQSDELYPKDPLKRAVVDQRLH---------FETGV 106
            :|.|.||...:..|:||:.||..|:    ...:|....|.|:..|:|.|:|         ||.  
  Rat    60 LPYLIDGSHKVTQSNAILRYLGRKHNLCGETEEERIRVDTLENQVMDTRIHLMIVCCSPDFEK-- 122

  Fly   107 LFHGIFKQLQRALFKENATEVPKDRLAELKDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTL 171
                     |:..|.::..|..|           :..:||.:.|:.||.::|..|| :...:...
  Rat   123 ---------QKPEFLKSIPEKMK-----------IYSEFLGKRPWFAGDKVTYVDF-LAYDILDQ 166

  Fly   172 HLSYCPVDATKYPKLSAWLARISALPFYEEDNLRGARLLADKIRSKLPK 220
            :..:.|.....:|.|..:|||...|..... .::.:..|...:.:|:|:
  Rat   167 YRMFEPECLDAFPNLKDFLARFEGLKKISA-YMKSSSFLPRPVFTKIPQ 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 37/154 (24%)
GST_N_Delta_Epsilon 4..77 CDD:239343 9/21 (43%)
GST_C_Delta_Epsilon 91..211 CDD:198287 26/128 (20%)
Gstm3lNP_065415.1 PTZ00057 3..203 CDD:173353 38/166 (23%)
GST_N_Mu 3..84 CDD:239373 9/23 (39%)
GST_C_Mu 92..212 CDD:198318 29/143 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D522554at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.