DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and gstm.3

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001156323.1 Gene:gstm.3 / 568744 ZFINID:ZDB-GENE-050309-24 Length:219 Species:Danio rerio


Alignment Length:219 Identity:50/219 - (22%)
Similarity:89/219 - (40%) Gaps:25/219 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PVRAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQ-----HTVPMLEDGESCIWDSHAIIG 73
            ||| :||.....:.:.:|::.. :|.|:.|.....:..:     ..:|.||||::.:..|:||:.
Zfish    16 PVR-LLLEFTGTKYEEKFYSCG-EAPDYDKSCWFNEKNKLGLAFPNLPYLEDGDTKVVQSNAILR 78

  Fly    74 YLVNKYAQSDELYPKDPLKRAVVDQRLHFETGVLFHGIFKQLQRALFKENATEVPKDRLAELKDA 138
            |:..|.....|...:......:.:|.:.|..|      |.||....|.:|.....:.....||. 
Zfish    79 YIARKNNLCGETEEEQTRVDILENQAMDFRNG------FIQLCYGDFDKNKPCYCEKLPGSLKQ- 136

  Fly   139 YALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDATKYPKLSAWLARISALP---FYE 200
               ...||.:..:.||.::|..|| |:..:..||....|.....|..|.::|....:|.   .|.
Zfish   137 ---FSDFLGDRKWFAGDKITFVDF-IMYDLLDLHRMLHPECLDDYRNLRSFLDHFESLEKIVAYM 197

  Fly   201 EDNLRGARLLADKIRSKLPKQFDK 224
            :.|    :.:...:.:|:.|..:|
Zfish   198 KSN----KYMKTPVNNKMAKWGNK 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 44/187 (24%)
GST_N_Delta_Epsilon 4..77 CDD:239343 18/67 (27%)
GST_C_Delta_Epsilon 91..211 CDD:198287 27/122 (22%)
gstm.3NP_001156323.1 GST_N_Mu 3..83 CDD:239373 18/68 (26%)
PTZ00057 5..201 CDD:173353 47/201 (23%)
GST_C_Mu 92..211 CDD:198318 27/133 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D522554at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.