DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and eef1e1

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001373479.1 Gene:eef1e1 / 565440 ZFINID:ZDB-GENE-030131-4949 Length:173 Species:Danio rerio


Alignment Length:143 Identity:36/143 - (25%)
Similarity:54/143 - (37%) Gaps:20/143 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VPMLEDGESCIWDSHAIIGYLVNKYAQSDELYPKDPLKRAVVDQRLHFETGVLFHGIFKQLQRAL 119
            ||:|::...........|...:.|.|:..||...|..:||||.|.|.       |.|.| |... 
Zfish    29 VPVLQNNNGPALTGLVTIACHLVKEAKRPELLGDDAEQRAVVQQWLE-------HRITK-LDNC- 84

  Fly   120 FKENATEVPKDRLAELKDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDATKYP 184
            .||....:.||           |.::|.:..|:||...|:||..:...:..:.:.....:...|.
Zfish    85 SKEEVKVILKD-----------LNRYLEDKVYLAGNVFTLADILMYYGIHHIIVELAIQEKECYL 138

  Fly   185 KLSAWLARISALP 197
            .:|.|...|...|
Zfish   139 NVSRWFDHIQHYP 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 35/141 (25%)
GST_N_Delta_Epsilon 4..77 CDD:239343 4/21 (19%)
GST_C_Delta_Epsilon 91..211 CDD:198287 27/107 (25%)
eef1e1NP_001373479.1 GST_C_AIMP3 64..161 CDD:198338 27/108 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.