DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and CLIC6

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_016883895.1 Gene:CLIC6 / 54102 HGNCID:2065 Length:735 Species:Homo sapiens


Alignment Length:233 Identity:51/233 - (21%)
Similarity:77/233 - (33%) Gaps:93/233 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ESSPPVRAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLEDGESCIWDSHAIIGY 74
            |:|.|        |||..:|:. ||.::||                   .||||        || 
Human   440 EASEP--------RALGQEHDI-TLFVKAG-------------------YDGES--------IG- 467

  Fly    75 LVNKYAQSDELYPKDPLKRAVVDQRLH---FETGVLFHGIFKQLQRALFKENATEVPKD--RLA- 133
                              .....|||.   :..||:|:.....|:|.         |.|  .|| 
Human   468 ------------------NCPFSQRLFMILWLKGVIFNVTTVDLKRK---------PADLQNLAP 505

  Fly   134 -----------ELKDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDATKYPKLS 187
                       |:|.....:|:||.|.  :|.|:        ...:.|.|..........:.|.|
Human   506 GTNPPFMTFDGEVKTDVNKIEEFLEEK--LAPPR--------YPKLGTQHPESNSAGNDVFAKFS 560

  Fly   188 AWL--ARISALPFYEEDNLRGARLLADKIRSKLPKQFD 223
            |::  .:..|...:|::.|:..|.|.:.:.|.||.:.|
Human   561 AFIKNTKKDANEIHEKNLLKALRKLDNYLNSPLPDEID 598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 43/205 (21%)
GST_N_Delta_Epsilon 4..77 CDD:239343 17/66 (26%)
GST_C_Delta_Epsilon 91..211 CDD:198287 29/138 (21%)
CLIC6XP_016883895.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154373
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.