DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and CLIC5

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001107558.1 Gene:CLIC5 / 53405 HGNCID:13517 Length:410 Species:Homo sapiens


Alignment Length:251 Identity:43/251 - (17%)
Similarity:75/251 - (29%) Gaps:110/251 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GYLV--NKYAQSDELYPKDPLKRAVVDQRLHFETGVLFHGIF-----KQLQRALFKENATEVPKD 130
            |||:  ..|::..|.:|.:|.:          :.|:...|::     :||..|..:||.:.:.:|
Human    80 GYLLPDEIYSELQEAHPGEPQE----------DRGISMEGLYSSTQDQQLCAAELQENGSVMKED 134

  Fly   131 ---------------------------RLAELKDAYALLEQFLAENPYVAGPQLTIADFS----- 163
                                       .|.|.:.|:...|.:|.....:.|..:....||     
Human   135 LPSPSSFTIQHSKAFSTTKYSCYSDAEGLEEKEGAHMNPEIYLFVKAGIDGESIGNCPFSQRLFM 199

  Fly   164 ------IVATVSTLHLSYCPVD-----------------------------------ATKYPKLS 187
                  :|..|:|:.|...|.|                                   ..|||||:
Human   200 ILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLA 264

  Fly   188 A-----------WLARISAL---------PFYEEDNLRGARLLADKIRSKLPKQFD 223
            |           ..::.||.         ...|....:..:.|.|.:.:.||::.|
Human   265 AKHRESNTAGIDIFSKFSAYIKNTKQQNNAALERGLTKALKKLDDYLNTPLPEEID 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 37/223 (17%)
GST_N_Delta_Epsilon 4..77 CDD:239343 3/5 (60%)
GST_C_Delta_Epsilon 91..211 CDD:198287 31/217 (14%)
CLIC5NP_001107558.1 O-ClC 173..408 CDD:129941 25/148 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154553
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.