DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and GstD8

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster


Alignment Length:208 Identity:75/208 - (36%)
Similarity:117/208 - (56%) Gaps:8/208 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SPPVRAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLEDGESCIWDSHAIIGYLV 76
            |.|.|:|::|.:||.:|.....|.:..|:.|||:.::.||||.:|.|.|....||:|.||:.|||
  Fly     9 SAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRAILIYLV 73

  Fly    77 NKYAQSDELYPKDPLKRAVVDQRLHFETGVLFHGIFKQLQRALFKENATEVPKD--RLAELKDAY 139
            .||...|.|||.||.|:|||:|||:|:.|.||....:    |::.:.....|.|  .:.::..|:
  Fly    74 EKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVE----AIYPQIRNNHPADPEAMQKVDSAF 134

  Fly   140 ALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDATKYPKLSAWLARISALPFYEEDNL 204
            ..|:.||.:..||||..|||||.:::|:|||..:  ...|..:||.::.|......:....|:|.
  Fly   135 GHLDTFLEDQEYVAGDCLTIADIALLASVSTFEV--VDFDIAQYPNVARWYENAKEVTPGWEENW 197

  Fly   205 RGARLLADKIRSK 217
            .|.:|:...::.:
  Fly   198 DGVQLIKKLVQER 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 71/186 (38%)
GST_N_Delta_Epsilon 4..77 CDD:239343 27/64 (42%)
GST_C_Delta_Epsilon 91..211 CDD:198287 39/121 (32%)
GstD8NP_524916.1 GstA 1..188 CDD:223698 71/184 (39%)
GST_N_Delta_Epsilon 1..74 CDD:239343 27/64 (42%)
GST_C_Delta_Epsilon 88..204 CDD:198287 39/121 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460262
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.