DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and GstD6

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster


Alignment Length:221 Identity:83/221 - (37%)
Similarity:126/221 - (57%) Gaps:16/221 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGTESSPPVRAVLLTLRALQLDHEFHTLDMQ--AGDHLKPDMLRKNPQHTVPMLEDGESCIWDS 68
            ||....||..|||::|.:|:.:  ||:::.:.  .|:.|:|..::.|||||:|.|.|....||::
  Fly     3 LYNMSGSPSTRAVMMTAKAVGV--EFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWET 65

  Fly    69 HAIIGYLVNKYAQSDELYPKDPLKRAVVDQRLHFETGVLFHGIFKQLQRALFKENATEVP--KDR 131
            .||:.|||.:|.:.|.||||||.|:|:::|||:|:.|.|:.||.|.    .|....|..|  ::.
  Fly    66 RAIVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKY----FFPLLRTGKPGTQEN 126

  Fly   132 LAELKDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDATKYPKLSAWLARISAL 196
            |.:|..|:.||..||....||||.||::||..|:|||||..:  ...|..|:|.:..|......:
  Fly   127 LEKLNAAFDLLNNFLDGQDYVAGNQLSVADIVILATVSTTEM--VDFDLKKFPNVDRWYKNAQKV 189

  Fly   197 -PFYEEDNLR---GARLLADKIRSKL 218
             |.::|:..|   ..:.||:.:..||
  Fly   190 TPGWDENLARIQSAKKFLAENLIEKL 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 76/195 (39%)
GST_N_Delta_Epsilon 4..77 CDD:239343 28/72 (39%)
GST_C_Delta_Epsilon 91..211 CDD:198287 42/125 (34%)
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 28/72 (39%)
PLN02395 11..208 CDD:166036 75/204 (37%)
GST_C_Delta_Epsilon 88..204 CDD:198287 42/121 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460314
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.