DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and gstm1

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001004964.1 Gene:gstm1 / 448387 XenbaseID:XB-GENE-971384 Length:216 Species:Xenopus tropicalis


Alignment Length:146 Identity:35/146 - (23%)
Similarity:59/146 - (40%) Gaps:16/146 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VPMLEDGESCIWDSHAIIGYLVNKYAQSDELYPKDPLKRAVVDQRLHFETG---VLFHGIFKQLQ 116
            :|.|.||:..:..|:||:.|:..|:....|...:......:.:|.:.|..|   :.::..|:.|:
 Frog    58 LPYLLDGDVKLSQSNAILRYIARKHGLCGESEKEKMYVDLIENQTMDFRMGLVVIAYNPQFETLK 122

  Fly   117 RALFKENATEVPKDRLAELKDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDAT 181
            ...            |.:|..|......||.:..:.||.::|..|| :|..|...|....|....
 Frog   123 GPY------------LEKLPIALKRFSCFLGDRSWFAGDKITFVDF-VVYDVLDQHQILEPTCLQ 174

  Fly   182 KYPKLSAWLARISALP 197
            .:..|..:|.|..|||
 Frog   175 NFKNLQDFLKRFEALP 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 33/144 (23%)
GST_N_Delta_Epsilon 4..77 CDD:239343 8/21 (38%)
GST_C_Delta_Epsilon 91..211 CDD:198287 25/110 (23%)
gstm1NP_001004964.1 GST_N_Mu 1..82 CDD:239373 8/23 (35%)
GST_C_Mu 90..210 CDD:198318 25/114 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D522554at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.