DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and GstD9

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster


Alignment Length:199 Identity:78/199 - (39%)
Similarity:115/199 - (57%) Gaps:7/199 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ILYGTESSPPVRAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLEDGESCIWDSH 69
            :||    |.|.|::|:|.|||.|:.....:|:.||:||||:.::.|||||:|.|.|....||:|.
  Fly     7 MLY----SAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWESR 67

  Fly    70 AIIGYLVNKYAQSDELYPKDPLKRAVVDQRLHFETGVLFHGIFKQLQRALFKENATEVPKDRLAE 134
            ||:.||..||.:...||||||.:|||::|||.|:...|:..........||::.......|.|.:
  Fly    68 AILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPADPDNLKK 132

  Fly   135 LKDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDATKYPKLSAWLARI-SALPF 198
            :.||:|:....|....|.|..:||:|||:::|||||..:|  ..|..|||::..|.... ..:|.
  Fly   133 IDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEIS--EYDFGKYPEVVRWYDNAKKVIPG 195

  Fly   199 YEED 202
            :||:
  Fly   196 WEEN 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 75/192 (39%)
GST_N_Delta_Epsilon 4..77 CDD:239343 33/71 (46%)
GST_C_Delta_Epsilon 91..211 CDD:198287 37/113 (33%)
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 33/71 (46%)
GstA 4..187 CDD:223698 75/185 (41%)
GST_C_Delta_Epsilon 89..207 CDD:198287 37/113 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460288
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.