DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and clic5b

DIOPT Version :10

Sequence 1:NP_611322.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_998062.1 Gene:clic5b / 405833 ZFINID:ZDB-GENE-040426-2542 Length:408 Species:Danio rerio


Alignment Length:71 Identity:21/71 - (29%)
Similarity:34/71 - (47%) Gaps:7/71 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 KQLQRALFKENATEVPKDRLAELKDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCP 177
            |.|.:||.|  ..|.....|.:..||.::.|:..:...::.|..||:||.::   :..||:  ..
Zfish   297 KGLTKALKK--LDEYLNSPLPDEVDADSMEEEKASNRRFLDGNDLTLADCNL---LPKLHI--VK 354

  Fly   178 VDATKY 183
            |.|.||
Zfish   355 VVAKKY 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_611322.1 GST_N_Delta_Epsilon 4..77 CDD:239343
GST_C_Delta_Epsilon 91..211 CDD:198287 21/71 (30%)
clic5bNP_998062.1 EFh_CREC <53..150 CDD:330175
EF-hand motif 81..119 CDD:320021
EF-hand motif 126..150 CDD:320021
O-ClC 172..407 CDD:129941 21/71 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.