DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and gstt2

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_956815.2 Gene:gstt2 / 393493 ZFINID:ZDB-GENE-040426-1617 Length:228 Species:Danio rerio


Alignment Length:226 Identity:65/226 - (28%)
Similarity:101/226 - (44%) Gaps:37/226 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SPPVRAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLEDGESCIWDSHAIIGYLV 76
            |.|.||||:.|:..::.|....:.::.|:...|:..:.||...||:|||....:.:|.||:.||.
Zfish    15 SQPCRAVLIFLKHNKIPHTVEQIAIRKGEQKTPEFTKLNPMQKVPVLEDNGFVLTESDAILKYLA 79

  Fly    77 NKYAQSDELYPKDPLKRAVVDQ---------RLHFETGVLFHGIFKQLQRALFKENATEVPKDRL 132
            ..|...|..|||.|.|||.||:         |:|..| |.:..:...|.... ..|..::.| .|
Zfish    80 TTYKVPDHWYPKLPEKRARVDEYTAWHHMNTRMHAAT-VFWQEVLLPLMTGQ-PANTAKLEK-AL 141

  Fly   133 AELKDAYALLE-QFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPV--------DATK-YPKLS 187
            ::|......|| .||....::.|..:::||.          |:.|.:        |..| .|||.
Zfish   142 SDLSGTLDKLENMFLKRQAFLCGDDISLADL----------LAICELMQPMSSGRDILKDRPKLL 196

  Fly   188 AWLARI-SALPFYEEDNLRGARLLADKIRSK 217
            :|.:|: |||    .|:...|..:..::|.|
Zfish   197 SWRSRVQSAL----SDSFDEAHTIVYRLRDK 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 60/204 (29%)
GST_N_Delta_Epsilon 4..77 CDD:239343 22/64 (34%)
GST_C_Delta_Epsilon 91..211 CDD:198287 35/139 (25%)
gstt2NP_956815.2 GST_N_Theta 7..82 CDD:239348 22/66 (33%)
GST_C_Theta 95..220 CDD:198292 35/141 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589536
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.