DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and GstO2

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster


Alignment Length:229 Identity:58/229 - (25%)
Similarity:95/229 - (41%) Gaps:50/229 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VLLTLRALQLDHEFHTLDMQAGDHLKPDMLRK-NPQHTVPMLE----DGESCIWDSHAIIGYLVN 77
            |.|.|.|..::|....:|:..    ||:..:. :|...||.|:    ..:..:.:|..|..||..
  Fly    37 VRLMLAAKHIEHHKIYVDLIE----KPEWYKDFSPLGKVPALQLTGVKDQPTLVESLIIAEYLDQ 97

  Fly    78 KYAQSDELYPKDPLKRAVVDQRLHFETGVLFHGIFKQLQRALFKENATEVPKDRLAELKDAYALL 142
            :|.|: .|:|.|||::| :|:.|......:...|:..|   ....||   |||.:...::|..:.
  Fly    98 QYPQT-RLFPTDPLQKA-LDKILIERFAPVVSAIYPVL---TCNPNA---PKDAIPNFENALDVF 154

  Fly   143 EQFLAE--NPYVAGPQLTIADFSIVATVSTLHLSYCPVDATKYPKLSAWLARISALPF-----YE 200
            |..|.:  .||.||..:.|.|:.|                  :|    |..|..::..     ||
  Fly   155 EVELGKRGTPYFAGQHIGIVDYMI------------------WP----WFERFPSMKINTEQKYE 197

  Fly   201 EDNLRGARLLADKIRSKLPKQFDKLWQKAFEDIK 234
            .|..|..:||  |.|..:.:  |::.||...|::
  Fly   198 LDTKRFEKLL--KWRDLMTQ--DEVVQKTALDVQ 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 46/185 (25%)
GST_N_Delta_Epsilon 4..77 CDD:239343 16/63 (25%)
GST_C_Delta_Epsilon 91..211 CDD:198287 29/126 (23%)
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 15/62 (24%)
GstA 25..215 CDD:223698 54/213 (25%)
GST_C_Omega 110..235 CDD:198293 36/151 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460198
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.