DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE10 and se

DIOPT Version :9

Sequence 1:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster


Alignment Length:237 Identity:65/237 - (27%)
Similarity:104/237 - (43%) Gaps:52/237 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LILYGTESSPPVRAVLLTLRALQLDHEFHTLDMQAGDHLKPD-MLRKNPQHTVPML----EDGES 63
            |.||.....|..:.|.|.|.|.|:  .:|::.:...|  ||: :|.||||..||.|    |.|..
  Fly    22 LRLYSMRFCPFAQRVHLVLDAKQI--PYHSIYINLTD--KPEWLLEKNPQGKVPALEIVREPGPP 82

  Fly    64 CIWDSHAIIGYLVNKYAQSDELYPKDPLKRAVVDQRLHFETGVLFHGIFKQLQRALFKENATEVP 128
            .:.:|..|..||..:|... .|||:||||:  |..:|..|.       |:.:..|.||.:..   
  Fly    83 VLTESLLICEYLDEQYPLR-PLYPRDPLKK--VQDKLLIER-------FRAVLGAFFKASDG--- 134

  Fly   129 KDRLAELKDAYALLEQFLAE-----NPYVAGPQLTIADFSIVATVSTLHL---------SYCPVD 179
                .:|:..::.|:.:..|     ..:..|.|..|.|:.|......|.|         :|   |
  Fly   135 ----GDLEPFWSGLDIYERELARRGTEFFGGEQTGILDYMIWPWCERLELLKLQRGEDYNY---D 192

  Fly   180 ATKYPKLSAWLARI----SALPFYEEDNLRGARLLADKIRSK 217
            .:::|:|:.||.|:    :.:.||.|     |.:.|:.:|::
  Fly   193 QSRFPQLTLWLERMKRDPAVMAFYME-----AEVQAEFLRTR 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 59/215 (27%)
GST_N_Delta_Epsilon 4..77 CDD:239343 27/77 (35%)
GST_C_Delta_Epsilon 91..211 CDD:198287 30/137 (22%)
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 26/76 (34%)
GstA 22..215 CDD:223698 59/216 (27%)
GST_C_Omega 109..229 CDD:198293 32/143 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460159
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.